![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein) |
![]() | Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species) |
![]() | Species Plasmodium yoelii [TaxId:73239] [255502] (2 PDB entries) |
![]() | Domain d2mgra2: 2mgr A:49-99 [243184] automated match to d1ceja2 mutant |
PDB Entry: 2mgr (more details)
SCOPe Domain Sequences for d2mgra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgra2 g.3.11.4 (A:49-99) Merozoite surface protein 1 (MSP-1) {Plasmodium yoelii [TaxId: 73239]} nptcdinnggcdptascqnaestenskkiictckeptpnayyegvfcssss
Timeline for d2mgra2: