PDB entry 2mgr

View 2mgr on RCSB PDB site
Description: Structure of Plasmodium Yoelii Merozoite Surface Protein 1 - C-terminal Domain, E28K mutant
Class: membrane protein
Keywords: membrane protein
Deposited on 2013-11-04, released 2014-02-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Merozoite surface protein 1
    Species: Plasmodium yoelii yoelii [TaxId:73239]
    Gene: MSP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13828 (0-98)
      • engineered mutation (24)
      • engineered mutation (27)
    Domains in SCOPe 2.04: d2mgra1, d2mgra2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2mgrA (A:)
    gvdpkhvcvdtrdipknagcfrdddgtkewrcllgykkgegntcvennnptcdinnggcd
    ptascqnaestenskkiictckeptpnayyegvfcssss