SCOPe 2.05: Domain d2mgpa1: 2mgp A:1-48

Lineage for d2mgpa1 (2mgp A:1-48)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)

6. Protein Merozoite surface protein 1 (MSP-1) [57240] (5 species)

7. Species Plasmodium yoelii [TaxId:73239] [255502] (2 PDB entries)

8. Domain d2mgpa1: 2mgp A:1-48 [243181]
   automated match to d1ob1c1

Details for d2mgpa1

PDB Entry: 2mgp

PDB Description: Structure of Plasmodium Yoelii Merozoite Surface Protein 1 - C-terminal Domain

PDB Compounds: (A:) Merozoite surface protein 1

SCOPe Domain Sequences for d2mgpa1:

Sequence; same for both SEQRES and ATOM records:

>d2mgpa1 g.3.11.4 (A:1-48) Merozoite surface protein 1 (MSP-1) {Plasmodium yoelii [TaxId: 73239]}
gvdpkhvcvdtrdipknagcfrdddgteewrcllgykkgegntcvenn

Timeline for d2mgpa1:

• d2mgpa1 first appeared in SCOPe 2.04
  
• d2mgpa1 appears in SCOPe 2.06
  
• d2mgpa1 appears in the current release, SCOPe 2.08