SCOPe 2.06: Domain d2m3ma1: 2m3m A:318-406

Lineage for d2m3ma1 (2m3m A:318-406)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (40 PDB entries)

8. Domain d2m3ma1: 2m3m A:318-406 [243092]
   Other proteins in same PDB: d2m3ma2
   automated match to d3rl8c_

Details for d2m3ma1

PDB Entry: 2m3m

PDB Description: solution structure of a complex consisting of hdlg/sap-97 residues 318-406 and hpv51 oncoprotein e6 residues 141-151

PDB Compounds: (A:) Disks large homolog 1

SCOPe Domain Sequences for d2m3ma1:

Sequence; same for both SEQRES and ATOM records:

>d2m3ma1 b.36.1.1 (A:318-406) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgklqigdkllavnnv
cleevtheeavtalkntsdfvylkvakpt

Timeline for d2m3ma1:

• d2m3ma1 first appeared in SCOPe 2.04, called d2m3ma_
  
• d2m3ma1 was called d2m3ma_ in SCOPe 2.05
  
• d2m3ma1 appears in SCOPe 2.07
  
• d2m3ma1 appears in the current release, SCOPe 2.08