![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
![]() | Protein automated matches [190485] (8 species) not a true protein |
![]() | Species Centruroides suffusus [TaxId:6881] [255438] (2 PDB entries) |
![]() | Domain d2ljma1: 2ljm A:17-82 [242903] Other proteins in same PDB: d2ljma2 automated match to d2ybri_ |
PDB Entry: 2ljm (more details)
SCOPe Domain Sequences for d2ljma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljma1 g.3.7.1 (A:17-82) automated matches {Centruroides suffusus [TaxId: 6881]} kegylvskstgckyeclklgdndyclreckqqygkssggycyafacwcthlyeqavvwpl pnktcn
Timeline for d2ljma1: