PDB entry 2ljm

View 2ljm on RCSB PDB site
Description: Solution Structure of CssII
Class: toxin
Keywords: CS alfa beta, TOXIN
Deposited on 2011-09-20, released 2012-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-mammal toxin Css2
  Species: Centruroides suffusus suffusus [TaxId:6881]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08900 (16-81)
    • expression tag (0-15)
  Domains in SCOPe 2.06: d2ljma1, d2ljma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ljmA (A:)
  mrgshhhhhhgsiegrkegylvskstgckyeclklgdndyclreckqqygkssggycyaf
  acwcthlyeqavvwplpnktcn