Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.4: Parvalbumin [47492] (3 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
Protein automated matches [254433] (3 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [255387] (2 PDB entries) |
Domain d2kyca_: 2kyc A: [242696] automated match to d1rroa_ |
PDB Entry: 2kyc (more details)
SCOPe Domain Sequences for d2kyca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kyca_ a.39.1.4 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} sltdilspsdiaaalrdcqapdsfspkkffqisgmskksssqlkeifrildndqsgfiee delkyflqrfesgarvltasetktflaaadhdgdgkigaeefqemvqs
Timeline for d2kyca_: