SCOPe 2.05: Domain d2ksoa_: 2kso A:

Lineage for d2ksoa_ (2kso A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (21 PDB entries)

8. Domain d2ksoa_: 2kso A: [242636]
   automated match to d1f0ma_

Details for d2ksoa_

PDB Entry: 2kso

PDB Description: epha2:ship2 sam:sam complex

PDB Compounds: (A:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d2ksoa_:

Sequence; same for both SEQRES and ATOM records:

>d2ksoa_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglkd
qvntv

Timeline for d2ksoa_:

• d2ksoa_ first appeared in SCOPe 2.04
  
• d2ksoa_ appears in SCOPe 2.06
  
• d2ksoa_ appears in the current release, SCOPe 2.08