Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
Protein automated matches [190031] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries) |
Domain d2ksoa_: 2kso A: [242636] automated match to d1f0ma_ |
PDB Entry: 2kso (more details)
SCOPe Domain Sequences for d2ksoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ksoa_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvsewlesikmqqytehfmaagytaiekvvqmtnddikrigvrlpghqkriaysllglkd qvntv
Timeline for d2ksoa_: