Lineage for d2kiva2 (2kiv A:70-135)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715571Family a.60.1.0: automated matches [191306] (1 protein)
    not a true family
  6. 2715572Protein automated matches [190031] (3 species)
    not a true protein
  7. 2715581Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)
  8. 2715645Domain d2kiva2: 2kiv A:70-135 [242532]
    automated match to d1b4fg_

Details for d2kiva2

PDB Entry: 2kiv (more details)

PDB Description: aida-1 sam domain tandem
PDB Compounds: (A:) Ankyrin repeat and sterile alpha motif domain-containing protein 1B

SCOPe Domain Sequences for d2kiva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kiva2 a.60.1.0 (A:70-135) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hdgahptsvaewldsielgdytkaflingytsmdllkkiaevelinvlkinlighrkril
aslgdr

SCOPe Domain Coordinates for d2kiva2:

Click to download the PDB-style file with coordinates for d2kiva2.
(The format of our PDB-style files is described here.)

Timeline for d2kiva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kiva1