SCOPe 2.04: Domain d2kiva1: 2kiv A:1-69

Lineage for d2kiva1 (2kiv A:1-69)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (18 PDB entries)

8. Domain d2kiva1: 2kiv A:1-69 [242531]
   automated match to d1b4fg_

Details for d2kiva1

PDB Entry: 2kiv

PDB Description: aida-1 sam domain tandem

PDB Compounds: (A:) Ankyrin repeat and sterile alpha motif domain-containing protein 1B

SCOPe Domain Sequences for d2kiva1:

Sequence; same for both SEQRES and ATOM records:

>d2kiva1 a.60.1.0 (A:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqtvgqwlesiglpqyenhlmangfdnvqamgsnvmedqdlleigilnsghrqrilqaiq
llpkmrpig

Timeline for d2kiva1:

• d2kiva1 is new in SCOPe 2.04-stable
  
• d2kiva1 appears in SCOPe 2.05
  
• d2kiva1 appears in the current release, SCOPe 2.08