PDB entry 2kiv

View 2kiv on RCSB PDB site
Description: AIDA-1 SAM domain tandem
Class: signaling protein
Keywords: SAM domain, tandem, signaling protein, Alternative splicing, ANK repeat, Cell junction, Cell membrane, Cell projection, Cytoplasm, Membrane, Nucleus, Phosphoprotein, Postsynaptic cell membrane, Synapse
Deposited on 2009-05-12, released 2009-08-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin repeat and sterile alpha motif domain-containing protein 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: AIDA-1b, ANKS1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7Z6G8 (13-147)
      • engineered (42)
      • engineered (85)
      • engineered (121)
    Domains in SCOPe 2.04: d2kiva1, d2kiva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kivA (A:)
    mhhhhhhlvprgsvqtvgqwlesiglpqyenhlmangfdnvqamgsnvmedqdlleigil
    nsghrqrilqaiqllpkmrpighdgahptsvaewldsielgdytkaflingytsmdllkk
    iaevelinvlkinlighrkrilaslgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kivA (A:)
    vqtvgqwlesiglpqyenhlmangfdnvqamgsnvmedqdlleigilnsghrqrilqaiq
    llpkmrpighdgahptsvaewldsielgdytkaflingytsmdllkkiaevelinvlkin
    lighrkrilaslgdr