Lineage for d2k9ga_ (2k9g A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783907Species Human (Homo sapiens) [TaxId:9606] [187598] (88 PDB entries)
  8. 1783994Domain d2k9ga_: 2k9g A: [242428]
    automated match to d1ue9a_

Details for d2k9ga_

PDB Entry: 2k9g (more details)

PDB Description: Solution structure of the third SH3 domain of the Cin85 adapter protein
PDB Compounds: (A:) SH3 domain-containing kinase-binding protein 1

SCOPe Domain Sequences for d2k9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k9ga_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smdsrtkskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpd
nfvkllppdfeke

SCOPe Domain Coordinates for d2k9ga_:

Click to download the PDB-style file with coordinates for d2k9ga_.
(The format of our PDB-style files is described here.)

Timeline for d2k9ga_: