SCOPe 2.04: Domain d2k9ga_: 2k9g A:

Lineage for d2k9ga_ (2k9g A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)

8. Domain d2k9ga_: 2k9g A: [242428]
   automated match to d1ue9a_

Details for d2k9ga_

PDB Entry: 2k9g

PDB Description: Solution structure of the third SH3 domain of the Cin85 adapter protein

PDB Compounds: (A:) SH3 domain-containing kinase-binding protein 1

SCOPe Domain Sequences for d2k9ga_:

Sequence; same for both SEQRES and ATOM records:

>d2k9ga_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smdsrtkskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpd
nfvkllppdfeke

Timeline for d2k9ga_:

• d2k9ga_ is new in SCOPe 2.04-stable
  
• d2k9ga_ appears in SCOPe 2.05
  
• d2k9ga_ appears in the current release, SCOPe 2.08, called d2k9ga1