Class b: All beta proteins [48724] (176 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (6 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries) |
Domain d2k20a_: 2k20 A: [242353] automated match to d4h11a_ |
PDB Entry: 2k20 (more details)
SCOPe Domain Sequences for d2k20a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k20a_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gtrefltfevplndsgsaglgvsvkgnrskenhadlgifvksiinggaaskdgrlrvndq liavngesllgkanqeametlrrsmstegnkrgmiqlivarris
Timeline for d2k20a_: