Lineage for d2jxla_ (2jxl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323718Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2324288Protein Troponin C [47503] (6 species)
  7. 2324323Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. 2324343Domain d2jxla_: 2jxl A: [242306]
    automated match to d3sd6a_
    complexed with ca; mutant

Details for d2jxla_

PDB Entry: 2jxl (more details)

PDB Description: solution structure of cardiac n-domain troponin c mutant f77w-v82a
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2jxla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jxla_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdewlvmmarcmkdds

SCOPe Domain Coordinates for d2jxla_:

Click to download the PDB-style file with coordinates for d2jxla_.
(The format of our PDB-style files is described here.)

Timeline for d2jxla_: