PDB entry 2jxl

View 2jxl on RCSB PDB site
Description: Solution structure of cardiac N-domain troponin C mutant F77W-V82A
Class: structural protein
Keywords: F77W, Tryptophan, TROPONIN C, cNTnC, CALCIUM, Acetylation, Muscle protein, Polymorphism, STRUCTURAL PROTEIN
Deposited on 2007-11-20, released 2007-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: troponin c, slow skeletal and cardiac muscles
  Species: Homo sapiens [TaxId:9606]
  Gene: TNNC1, TNNC
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
    • engineered (76)
    • engineered (81)
  Domains in SCOPe 2.07: d2jxla_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jxlA (A:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdewlvmmarcmkdds