SCOPe 2.06: Domain d2ggfa1: 2ggf A:327-450

Lineage for d2ggfa1 (2ggf A:327-450)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein automated matches [254534] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255185] (1 PDB entry)

8. Domain d2ggfa1: 2ggf A:327-450 [241931]
   Other proteins in same PDB: d2ggfa2, d2ggfa3
   automated match to d2nsza1

Details for d2ggfa1

PDB Entry: 2ggf

PDB Description: solution structure of the ma3 domain of human programmed cell death 4

PDB Compounds: (A:) Programmed cell death 4, isoform 1

SCOPe Domain Sequences for d2ggfa1:

Sequence; same for both SEQRES and ATOM records:

>d2ggfa1 a.118.1.14 (A:327-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaiimvlestgestfkmildl
lkslwksstitvdqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskqlrdl
cpsr

Timeline for d2ggfa1:

• d2ggfa1 first appeared in SCOPe 2.04, called d2ggfa_
  
• d2ggfa1 was called d2ggfa_ in SCOPe 2.05
  
• d2ggfa1 appears in SCOPe 2.07
  
• d2ggfa1 appears in the current release, SCOPe 2.08