Lineage for d2ggfa1 (2ggf A:327-450)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338934Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
    duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
    this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain
  6. 2338986Protein automated matches [254534] (2 species)
    not a true protein
  7. 2338987Species Human (Homo sapiens) [TaxId:9606] [255185] (1 PDB entry)
  8. 2338988Domain d2ggfa1: 2ggf A:327-450 [241931]
    Other proteins in same PDB: d2ggfa2, d2ggfa3
    automated match to d2nsza1

Details for d2ggfa1

PDB Entry: 2ggf (more details)

PDB Description: solution structure of the ma3 domain of human programmed cell death 4
PDB Compounds: (A:) Programmed cell death 4, isoform 1

SCOPe Domain Sequences for d2ggfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggfa1 a.118.1.14 (A:327-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaiimvlestgestfkmildl
lkslwksstitvdqmkrgyeriyneipdinldvphsysvlerfveecfqagiiskqlrdl
cpsr

SCOPe Domain Coordinates for d2ggfa1:

Click to download the PDB-style file with coordinates for d2ggfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ggfa1: