![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (6 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries) |
![]() | Domain d2g5mb_: 2g5m B: [241903] automated match to d2he2b_ |
PDB Entry: 2g5m (more details)
SCOPe Domain Sequences for d2g5mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5mb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ghmelfpvelekdseglgisiigmgagadmgleklgifvktvteggaahrdgriqvndll vevdgtslvgvtqsfaasvlrntkgrvrfmigrerpgeqsevaqliqqtleqe
Timeline for d2g5mb_: