SCOPe 2.05: Domain d2g5mb_: 2g5m B:

Lineage for d2g5mb_ (2g5m B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2g5mb_: 2g5m B: [241903]
   automated match to d2he2b_

Details for d2g5mb_

PDB Entry: 2g5m

PDB Description: spinophilin pdz domain

PDB Compounds: (B:) Neurabin-2

SCOPe Domain Sequences for d2g5mb_:

Sequence; same for both SEQRES and ATOM records:

>d2g5mb_ b.36.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ghmelfpvelekdseglgisiigmgagadmgleklgifvktvteggaahrdgriqvndll
vevdgtslvgvtqsfaasvlrntkgrvrfmigrerpgeqsevaqliqqtleqe

Timeline for d2g5mb_:

• d2g5mb_ first appeared in SCOPe 2.04
  
• d2g5mb_ is called d2g5mb1 in SCOPe 2.06
  
• d2g5mb_ appears in the current release, SCOPe 2.08, called d2g5mb1