SCOPe 2.08: Domain d2frya1: 2fry A:3-61

Lineage for d2frya1 (2fry A:3-61)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d2frya1: 2fry A:3-61 [241881]
   Other proteins in same PDB: d2frya2
   automated match to d1u5sa1

Details for d2frya1

PDB Entry: 2fry

PDB Description: solution structure of the third sh3 domain of human nck2 adaptor protein

PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d2frya1:

Sequence; same for both SEQRES and ATOM records:

>d2frya1 b.34.2.1 (A:3-61) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpknyvvvls

Timeline for d2frya1:

• d2frya1 first appeared in SCOPe 2.04, called d2frya_
  
• d2frya1 appears in SCOPe 2.07