SCOPe 2.06: Domain d2ebva1: 2ebv A:8-57

Lineage for d2ebva1 (2ebv A:8-57)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families)
   contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain

5. Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)

6. Protein Nuclear pore complex protein nup153 [161175] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161176] (2 PDB entries)
   Uniprot P49790 722-750

8. Domain d2ebva1: 2ebv A:8-57 [241717]
   Other proteins in same PDB: d2ebva2
   automated match to d3ch5b_
   complexed with zn

Details for d2ebva1

PDB Entry: 2ebv

PDB Description: solution structure of the third zf-ranbp domain from human nuclear pore complex protein nup153

PDB Compounds: (A:) Nuclear pore complex protein Nup153

SCOPe Domain Sequences for d2ebva1:

Sequence; same for both SEQRES and ATOM records:

>d2ebva1 g.41.11.1 (A:8-57) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]}
ssssctvttgtlgfgdkfkrpigswecsvccvsnnaednkcvscmsekpg

Timeline for d2ebva1:

• d2ebva1 first appeared in SCOPe 2.04, called d2ebva_
  
• d2ebva1 was called d2ebva_ in SCOPe 2.05
  
• d2ebva1 appears in SCOPe 2.07
  
• d2ebva1 appears in the current release, SCOPe 2.08