Class g: Small proteins [56992] (94 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain |
Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins) |
Protein Nuclear pore complex protein nup153 [161175] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [161176] (2 PDB entries) Uniprot P49790 722-750 |
Domain d2ebva1: 2ebv A:8-57 [241717] Other proteins in same PDB: d2ebva2 automated match to d3ch5b_ complexed with zn |
PDB Entry: 2ebv (more details)
SCOPe Domain Sequences for d2ebva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebva1 g.41.11.1 (A:8-57) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} ssssctvttgtlgfgdkfkrpigswecsvccvsnnaednkcvscmsekpg
Timeline for d2ebva1: