Lineage for d3ch5b_ (3ch5 B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263868Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 2263869Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 2263881Protein Nuclear pore complex protein nup153 [161175] (2 species)
  7. 2263885Species Norway rat (Rattus norvegicus) [TaxId:10116] [188480] (6 PDB entries)
  8. 2263893Domain d3ch5b_: 3ch5 B: [161628]
    Other proteins in same PDB: d3ch5a_
    automated match to d2gqea1
    complexed with gdp, mg, so4, zn

Details for d3ch5b_

PDB Entry: 3ch5 (more details), 2.1 Å

PDB Description: The crystal structure of the RanGDP-Nup153ZnF2 complex
PDB Compounds: (B:) Fragment of Nuclear pore complex protein Nup153

SCOPe Domain Sequences for d3ch5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ch5b_ g.41.11.1 (B:) Nuclear pore complex protein nup153 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gfgdkfkpaigtwdcdtclvqnkpeavkcvacetpkp

SCOPe Domain Coordinates for d3ch5b_:

Click to download the PDB-style file with coordinates for d3ch5b_.
(The format of our PDB-style files is described here.)

Timeline for d3ch5b_:

2263893
d3ch5b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d3ch5a_