Lineage for d2dzda2 (2dzd A:121-339)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979152Species Geobacillus thermodenitrificans [TaxId:33940] [255126] (1 PDB entry)
  8. 2979153Domain d2dzda2: 2dzd A:121-339 [241666]
    Other proteins in same PDB: d2dzda1, d2dzda3, d2dzdb1, d2dzdb3
    automated match to d1ulza3

Details for d2dzda2

PDB Entry: 2dzd (more details), 2.4 Å

PDB Description: crystal structure of the biotin carboxylase domain of pyruvate carboxylase
PDB Compounds: (A:) pyruvate carboxylase

SCOPe Domain Sequences for d2dzda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dzda2 d.142.1.0 (A:121-339) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kvkarhaavnagipvipgsdgpvdgledvvafaeahgypiiikaalggggrgmrivrsks
evkeaferakseakaafgsdevyveklienpkhievqilgdyegnivhlyerdcsvqrrh
qkvvevapsvslsdelrqriceaavqlmrsvgyvnagtveflvsgdefyfievnpriqve
htitemitgidivqsqiliadgcslhshevgipkqedir

SCOPe Domain Coordinates for d2dzda2:

Click to download the PDB-style file with coordinates for d2dzda2.
(The format of our PDB-style files is described here.)

Timeline for d2dzda2: