SCOPe 2.06: Domain d2d9xa1: 2d9x A:8-114

Lineage for d2d9xa1 (2d9x A:8-114)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)

8. Domain d2d9xa1: 2d9x A:8-114 [241528]
   Other proteins in same PDB: d2d9xa2, d2d9xa3
   automated match to d1wi1a_

Details for d2d9xa1

PDB Entry: 2d9x

PDB Description: solution structure of the ph domain of oxysterol binding protein- related protein 11 from human

PDB Compounds: (A:) Oxysterol binding protein-related protein 11

SCOPe Domain Sequences for d2d9xa1:

Sequence; same for both SEQRES and ATOM records:

>d2d9xa1 b.55.1.0 (A:8-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
envygylmkytnlvtgwqyrffvlnneaglleyfvneqsrnqkprgtlqlagavispsde
dshtftvnaasgeqyklratdakerqhwvsrlqictqhhteaigknn

Timeline for d2d9xa1:

• d2d9xa1 first appeared in SCOPe 2.04, called d2d9xa_
  
• d2d9xa1 was called d2d9xa_ in SCOPe 2.05
  
• d2d9xa1 appears in SCOPe 2.07
  
• d2d9xa1 appears in the current release, SCOPe 2.08