Lineage for d2d9xa_ (2d9x A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551373Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1551374Protein automated matches [190052] (5 species)
    not a true protein
  7. 1551393Species Human (Homo sapiens) [TaxId:9606] [186914] (32 PDB entries)
  8. 1551434Domain d2d9xa_: 2d9x A: [241528]
    automated match to d1wi1a_

Details for d2d9xa_

PDB Entry: 2d9x (more details)

PDB Description: Solution structure of the PH domain of Oxysterol binding protein-related protein 11 from human
PDB Compounds: (A:) Oxysterol binding protein-related protein 11

SCOPe Domain Sequences for d2d9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d9xa_ b.55.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgenvygylmkytnlvtgwqyrffvlnneaglleyfvneqsrnqkprgtlqlaga
vispsdedshtftvnaasgeqyklratdakerqhwvsrlqictqhhteaigknnsgpssg

SCOPe Domain Coordinates for d2d9xa_:

Click to download the PDB-style file with coordinates for d2d9xa_.
(The format of our PDB-style files is described here.)

Timeline for d2d9xa_: