Class g: Small proteins [56992] (100 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
Protein automated matches [190772] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries) |
Domain d1xwha1: 1xwh A:293-354 [240971] Other proteins in same PDB: d1xwha2 automated match to d2puyb_ complexed with zn |
PDB Entry: 1xwh (more details)
SCOPe Domain Sequences for d1xwha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xwha1 g.50.1.0 (A:293-354) automated matches {Human (Homo sapiens) [TaxId: 9606]} qknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqevqpra ee
Timeline for d1xwha1: