SCOPe 2.08: Domain d1xwha1: 1xwh A:293-354

Lineage for d1xwha1 (1xwh A:293-354)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187998] (28 PDB entries)

8. Domain d1xwha1: 1xwh A:293-354 [240971]
   Other proteins in same PDB: d1xwha2
   automated match to d2puyb_
   complexed with zn

Details for d1xwha1

PDB Entry: 1xwh

PDB Description: nmr structure of the first phd finger of autoimmune regulator protein (aire1): insights into apeced

PDB Compounds: (A:) Autoimmune regulator

SCOPe Domain Sequences for d1xwha1:

Sequence; same for both SEQRES and ATOM records:

>d1xwha1 g.50.1.0 (A:293-354) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqevqpra
ee

Timeline for d1xwha1:

• d1xwha1 first appeared in SCOPe 2.04, called d1xwha_
  
• d1xwha1 appears in SCOPe 2.07