PDB entry 1xwh

View 1xwh on RCSB PDB site
Description: NMR structure of the first phd finger of autoimmune regulator protein (AIRE1): insights into apeced
Class: transcription
Keywords: PHD domain, Zn binding domain, APECED, nucleosome, E3 ligase, TRANSCRIPTION
Deposited on 2004-11-01, released 2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Autoimmune regulator
  Species: Homo sapiens [TaxId:9606]
  Gene: aire1
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43918 (4-65)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d1xwha1, d1xwha2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xwhA (A:)
  gamaqknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqev
  qpraee