Lineage for d4m4yd_ (4m4y D:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709744Protein automated matches [254646] (27 species)
    not a true protein
  7. 1709857Species Influenza A virus [TaxId:641501] [255945] (7 PDB entries)
  8. 1709877Domain d4m4yd_: 4m4y D: [240519]
    Other proteins in same PDB: d4m4ya_, d4m4yc_, d4m4ye_
    automated match to d4n5zb_
    complexed with nag; mutant

Details for d4m4yd_

PDB Entry: 4m4y (more details), 2.2 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin with a stabilization mutation ha2 e47g
PDB Compounds: (D:) Hemagglutinin HA2 subunit

SCOPe Domain Sequences for d4m4yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4yd_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 641501]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaidgitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseeaklnre

SCOPe Domain Coordinates for d4m4yd_:

Click to download the PDB-style file with coordinates for d4m4yd_.
(The format of our PDB-style files is described here.)

Timeline for d4m4yd_: