Lineage for d4m4yc_ (4m4y C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531297Domain d4m4yc_: 4m4y C: [235527]
    Other proteins in same PDB: d4m4yb_, d4m4yd_, d4m4yf_
    automated match to d4m4ye_
    complexed with nag; mutant

Details for d4m4yc_

PDB Entry: 4m4y (more details), 2.2 Å

PDB Description: crystal structure of a 2009 h1n1 influenza virus hemagglutinin with a stabilization mutation ha2 e47g
PDB Compounds: (C:) Hemagglutinin HA1 subunit

SCOPe Domain Sequences for d4m4yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4yc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdk
itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
igkcpkyvkstklrlatglrnip

SCOPe Domain Coordinates for d4m4yc_:

Click to download the PDB-style file with coordinates for d4m4yc_.
(The format of our PDB-style files is described here.)

Timeline for d4m4yc_: