SCOPe 2.06: Domain d4k3xb1: 4k3x B:6-174

Lineage for d4k3xb1 (4k3x B:6-174)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries)

8. Domain d4k3xb1: 4k3x B:6-174 [240376]
   Other proteins in same PDB: d4k3xa_, d4k3xb2, d4k3xc_, d4k3xd2, d4k3xe_, d4k3xf2
   automated match to d4n5zb_
   complexed with nag, p4g

Details for d4k3xb1

PDB Entry: 4k3x, 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xb1:

Sequence; same for both SEQRES and ATOM records:

>d4k3xb1 h.3.1.1 (B:6-174) automated matches {Influenza A virus [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid

Timeline for d4k3xb1:

• d4k3xb1 first appeared in SCOPe 2.04, called d4k3xb_
  
• d4k3xb1 was called d4k3xb_ in SCOPe 2.05
  
• d4k3xb1 appears in SCOPe 2.07
  
• d4k3xb1 appears in the current release, SCOPe 2.08