Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (34 species) not a true protein |
Species Influenza A virus [TaxId:11320] [255822] (24 PDB entries) |
Domain d4k3xb1: 4k3x B:6-174 [240376] Other proteins in same PDB: d4k3xa_, d4k3xb2, d4k3xc_, d4k3xd2, d4k3xe_, d4k3xf2 automated match to d4n5zb_ complexed with nag, p4g |
PDB Entry: 4k3x (more details), 2.15 Å
SCOPe Domain Sequences for d4k3xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k3xb1 h.3.1.1 (B:6-174) automated matches {Influenza A virus [TaxId: 11320]} iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkid
Timeline for d4k3xb1: