SCOPe 2.05: Domain d4k3xb_: 4k3x B:

Lineage for d4k3xb_ (4k3x B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza A virus [TaxId:11320] [255822] (17 PDB entries)

8. Domain d4k3xb_: 4k3x B: [240376]
   Other proteins in same PDB: d4k3xa_, d4k3xc_, d4k3xe_
   automated match to d4n5zb_
   complexed with nag, p4g

Details for d4k3xb_

PDB Entry: 4k3x, 2.15 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)

PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d4k3xb_:

Sequence; same for both SEQRES and ATOM records:

>d4k3xb_ h.3.1.1 (B:) automated matches {Influenza A virus [TaxId: 11320]}
iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkids

Timeline for d4k3xb_:

• d4k3xb_ first appeared in SCOPe 2.04
  
• d4k3xb_ is called d4k3xb1 in SCOPe 2.06
  
• d4k3xb_ appears in the current release, SCOPe 2.08, called d4k3xb1