Lineage for d4ixaa_ (4ixa A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723285Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1723371Family a.4.6.0: automated matches [191513] (1 protein)
    not a true family
  6. 1723372Protein automated matches [190858] (14 species)
    not a true protein
  7. 1723430Species Staphylococcus epidermidis [TaxId:176280] [236417] (1 PDB entry)
  8. 1723431Domain d4ixaa_: 4ixa A: [240272]
    automated match to d4ixab_

Details for d4ixaa_

PDB Entry: 4ixa (more details), 2.15 Å

PDB Description: Structure of DNA-binding domain of the response regulator SaeR from Staphylococcus epidermidis
PDB Compounds: (A:) Response regulator SaeR

SCOPe Domain Sequences for d4ixaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixaa_ a.4.6.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
meqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydy
yedantvnvhihrireklekhdflpytittvwglgykfersr

SCOPe Domain Coordinates for d4ixaa_:

Click to download the PDB-style file with coordinates for d4ixaa_.
(The format of our PDB-style files is described here.)

Timeline for d4ixaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ixab_