Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) |
Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
Protein automated matches [254475] (3 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255804] (3 PDB entries) |
Domain d4g7op2: 4g7o P:258-318 [240156] Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of1, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op1 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7o (more details), 2.99 Å
SCOPe Domain Sequences for d4g7op2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7op2 a.4.13.0 (P:258-318) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d4g7op2: