![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
![]() | Protein RNA polymerase omega subunit [63564] (3 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [158241] (6 PDB entries) |
![]() | Domain d4g7oe_: 4g7o E: [202210] Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7of1, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7op1, d4g7op2, d4g7op3 automated match to d2o5ie_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 4g7o (more details), 2.99 Å
SCOPe Domain Sequences for d4g7oe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7oe_ a.143.1.1 (E:) RNA polymerase omega subunit {Thermus thermophilus HB8 [TaxId: 300852]} aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav twamkelltgrlvfgenlvpedrlqkemerlypv
Timeline for d4g7oe_: