SCOPe 2.04: Domain d4g7of1: 4g7o F:78-257

Lineage for d4g7of1 (4g7o F:78-257)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
   multihelical; consists of a conserved 4-helical core and a variable insert subdomain

4. Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families)

5. Family a.177.1.0: automated matches [254327] (1 protein)
   not a true family

6. Protein automated matches [254748] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [256265] (2 PDB entries)

8. Domain d4g7of1: 4g7o F:78-257 [240152]
   Other proteins in same PDB: d4g7oa1, d4g7oa2, d4g7ob1, d4g7ob2, d4g7oc_, d4g7od_, d4g7oe_, d4g7of2, d4g7of3, d4g7ok1, d4g7ok2, d4g7ol1, d4g7ol2, d4g7om_, d4g7on_, d4g7oo_, d4g7op2, d4g7op3
   automated match to d1smyf3
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d4g7of1

PDB Entry: 4g7o, 2.99 Å

PDB Description: Crystal structure of Thermus thermophilus transcription initiation complex containing 2 nt of RNA

PDB Compounds: (F:) RNA polymerase sigma factor

SCOPe Domain Sequences for d4g7of1:

Sequence; same for both SEQRES and ATOM records:

>d4g7of1 a.177.1.0 (F:78-257) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

Timeline for d4g7of1:

• d4g7of1 is new in SCOPe 2.04-stable
  
• d4g7of1 appears in SCOPe 2.05
  
• d4g7of1 appears in the current release, SCOPe 2.08