Lineage for d3nzjt_ (3nzj T:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1937404Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1937405Protein automated matches [190509] (10 species)
    not a true protein
  7. 1937419Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (12 PDB entries)
  8. 1937421Domain d3nzjt_: 3nzj T: [239520]
    Other proteins in same PDB: d3nzj1_, d3nzj2_, d3nzja_, d3nzjb_, d3nzjc_, d3nzjd_, d3nzje_, d3nzjg_, d3nzjh_, d3nzji_, d3nzjj_, d3nzjk_, d3nzjl_, d3nzjm_, d3nzjn_, d3nzjo_, d3nzjp_, d3nzjq_, d3nzjr_, d3nzjs_, d3nzju_, d3nzjv_, d3nzjw_, d3nzjx_, d3nzjy_, d3nzjz_
    automated match to d1irug_
    complexed with mes

Details for d3nzjt_

PDB Entry: 3nzj (more details), 2.4 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with ligand 2a
PDB Compounds: (T:) Proteasome component C1

SCOPe Domain Sequences for d3nzjt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzjt_ d.153.1.0 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d3nzjt_:

Click to download the PDB-style file with coordinates for d3nzjt_.
(The format of our PDB-style files is described here.)

Timeline for d3nzjt_: