Lineage for d3dj1a_ (3dj1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1786401Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1786402Protein automated matches [190436] (6 species)
    not a true protein
  7. 1786567Species Mouse (Mus musculus) [TaxId:10090] [189959] (13 PDB entries)
  8. 1786576Domain d3dj1a_: 3dj1 A: [239212]
    automated match to d3dj1b_
    complexed with so4

Details for d3dj1a_

PDB Entry: 3dj1 (more details), 1.8 Å

PDB Description: crystal structure of TIP-1 wild type
PDB Compounds: (A:) tax1-binding protein 3

SCOPe Domain Sequences for d3dj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dj1a_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrvseggpaei
aglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqqsml

SCOPe Domain Coordinates for d3dj1a_:

Click to download the PDB-style file with coordinates for d3dj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3dj1a_: