Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (94 PDB entries) |
Domain d2y5bf2: 2y5b F:76-152 [239023] Other proteins in same PDB: d2y5ba_, d2y5be_ automated match to d3nobh_ complexed with so4, zn |
PDB Entry: 2y5b (more details), 2.7 Å
SCOPe Domain Sequences for d2y5bf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y5bf2 d.15.1.1 (F:76-152) automated matches {Human (Homo sapiens) [TaxId: 9606]} hmqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdy niqkestlhlvlrlrgg
Timeline for d2y5bf2:
View in 3D Domains from other chains: (mouse over for more information) d2y5ba_, d2y5bb1, d2y5bb2, d2y5be_ |