![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
![]() | Protein automated matches [190627] (6 species) not a true protein |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [231218] (4 PDB entries) |
![]() | Domain d2qree1: 2qre E:2-181 [238834] Other proteins in same PDB: d2qrea_, d2qreb_, d2qrec_, d2qred_ automated match to d2ooxe1 complexed with amz |
PDB Entry: 2qre (more details), 3.01 Å
SCOPe Domain Sequences for d2qree1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qree1 d.37.1.1 (E:2-181) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} mdvqetqkgalkeiqafirsrtsydvlptsfrlivfdvtlfvktslslltlnnivsaplw dseankfaglltmadfvnvikyyyqsssfpeaiaeidkfrllglreverkigaippetiy vhpmhslmdaclamsksrarriplidvdgetgsemivsvltqyrilkfismncketamlr
Timeline for d2qree1: