Lineage for d2qred_ (2qre D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1948489Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 1948490Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
    automatically mapped to Pfam PF04739
  5. 1948491Family d.353.1.1: AMPKBI-like [160220] (4 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 1948505Protein automated matches [190789] (2 species)
    not a true protein
  7. 1948506Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [188232] (4 PDB entries)
  8. 1948514Domain d2qred_: 2qre D: [151293]
    Other proteins in same PDB: d2qrea_, d2qrec_, d2qree1, d2qree2, d2qreg1, d2qreg2
    automated match to d2ooxb1
    complexed with amz

Details for d2qred_

PDB Entry: 2qre (more details), 3.01 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase in complex with 5-aminoimidazole-4-carboxamide 1-beta-D-ribofuranotide (ZMP)
PDB Compounds: (D:) SPCC1919.03c protein

SCOPe Domain Sequences for d2qred_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qred_ d.353.1.1 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
qysteipafltsntlqelklpkppslpphlekcilnsntaykedqsvlpnpnhvllnhla
aantqlgvlalsattryhrkyvttamfknfd

SCOPe Domain Coordinates for d2qred_:

Click to download the PDB-style file with coordinates for d2qred_.
(The format of our PDB-style files is described here.)

Timeline for d2qred_: