Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (11 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255272] (6 PDB entries) |
Domain d2jj2a3: 2jj2 A:380-510 [238742] Other proteins in same PDB: d2jj2a1, d2jj2a2, d2jj2b1, d2jj2b2, d2jj2c1, d2jj2c2, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2i1, d2jj2i2, d2jj2j1, d2jj2j2, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ automated match to d1maba1 complexed with adp, anp, azi, gol, mg, po4, que |
PDB Entry: 2jj2 (more details), 2.4 Å
SCOPe Domain Sequences for d2jj2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jj2a3 a.69.1.0 (A:380-510) automated matches {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallskirtdgkiseesdaklke ivtnflagfea
Timeline for d2jj2a3:
View in 3D Domains from other chains: (mouse over for more information) d2jj2b1, d2jj2b2, d2jj2b3, d2jj2c1, d2jj2c2, d2jj2c3, d2jj2d1, d2jj2d2, d2jj2d3, d2jj2e1, d2jj2e2, d2jj2e3, d2jj2f1, d2jj2f2, d2jj2f3, d2jj2g_, d2jj2h1, d2jj2h2, d2jj2h3, d2jj2i1, d2jj2i2, d2jj2i3, d2jj2j1, d2jj2j2, d2jj2j3, d2jj2k1, d2jj2k2, d2jj2k3, d2jj2l1, d2jj2l2, d2jj2l3, d2jj2m1, d2jj2m2, d2jj2m3, d2jj2n_ |