Lineage for d1maba1 (1mab A:380-510)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002731Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2002732Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2002733Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2002734Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2002799Species Norway rat (Rattus norvegicus) [TaxId:10116] [88925] (1 PDB entry)
  8. 2002800Domain d1maba1: 1mab A:380-510 [18311]
    Other proteins in same PDB: d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabb3, d1mabg_
    complexed with adp, atp, mg, po4

Details for d1maba1

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase
PDB Compounds: (A:) protein (f1-ATPase alpha chain)

SCOPe Domain Sequences for d1maba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maba1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfesaflshvvsqhqsllgnirtdgkiseqsdaklke
ivtnflagfep

SCOPe Domain Coordinates for d1maba1:

Click to download the PDB-style file with coordinates for d1maba1.
(The format of our PDB-style files is described here.)

Timeline for d1maba1: