Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
Domain d5hmge_: 5hmg E: [23836] Other proteins in same PDB: d5hmgb_, d5hmgd_, d5hmgf_ complexed with nag, sia |
PDB Entry: 5hmg (more details), 3.2 Å
SCOPe Domain Sequences for d5hmge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hmge_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki tygacpkyvkqntlklatgmrnvpekqt
Timeline for d5hmge_: