SCOPe 2.04: Domain d4ocmc_: 4ocm C:

Lineage for d4ocmc_ (4ocm C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries)

8. Domain d4ocmc_: 4ocm C: [237872]
   automated match to d4ocnc_
   complexed with k, zn

Details for d4ocmc_

PDB Entry: 4ocm, 1.99 Å

PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ib

PDB Compounds: (C:) Nb1

SCOPe Domain Sequences for d4ocmc_:

Sequence; same for both SEQRES and ATOM records:

>d4ocmc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh

Timeline for d4ocmc_:

• d4ocmc_ first appeared in SCOPe 2.03
  
• d4ocmc_ appears in SCOPe 2.05
  
• d4ocmc_ appears in the current release, SCOPe 2.08, called d4ocmc1