Lineage for d4ocnc_ (4ocn C:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (19 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries) 
Domain d4ocnc_: 4ocn C: [236488]
automated match to d3ogog_
Details for d4ocnc_
PDB Entry: 4ocn (more details), 2.25 Å
PDB Description: crystal structure of the rpn8-rpn11 mpn domain heterodimer, crystal form ii
PDB Compounds: (C:) Nb1SCOPe Domain Sequences for d4ocnc_:
Sequence, based on SEQRES records: (download)
>d4ocnc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrtfsstvmawfrqapgkerefvatirwsggntyya
dsvkgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvs
shhhh
Sequence, based on observed residues (ATOM records): (download)
>d4ocnc_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvpaggslrlscvdsgrstvmawfrqapgkerefvatirwsggntyyadsv
kgrftisrdnarntvylqmnslkpedtavyycaggtyygtlsykydfwgrgtqvtvsshh
hh
SCOPe Domain Coordinates for d4ocnc_:
Click to download the PDB-style file with coordinates for d4ocnc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ocnc_:
- d4ocnc_ first appeared in SCOPe 2.03
- d4ocnc_ appears in SCOPe 2.05
- d4ocnc_ appears in the current release, SCOPe 2.08, called d4ocnc1
View in 3D
