Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.0: automated matches [191468] (1 protein) not a true family |
Protein automated matches [190734] (14 species) not a true protein |
Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (15 PDB entries) |
Domain d3g2cb_: 3g2c B: [236715] Other proteins in same PDB: d3g2ca2 automated match to d3fzia_ protein/DNA complex; complexed with gol, mg, po4 |
PDB Entry: 3g2c (more details), 2.3 Å
SCOPe Domain Sequences for d3g2cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g2cb_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]} vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl kyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawid kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd vmgsdhcpigleiel
Timeline for d3g2cb_: