Lineage for d3g2cb_ (3g2c B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437447Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 1437448Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 1437550Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 1437551Protein automated matches [190734] (7 species)
    not a true protein
  7. 1437555Species Methanothermobacter thermautotrophicus [TaxId:187420] [229730] (11 PDB entries)
  8. 1437568Domain d3g2cb_: 3g2c B: [236715]
    automated match to d3fzia_
    protein/DNA complex; complexed with gol, mg, po4

Details for d3g2cb_

PDB Entry: 3g2c (more details), 2.3 Å

PDB Description: mth0212 in complex with a short ssdna (cgta)
PDB Compounds: (B:) exodeoxyribonuclease

SCOPe Domain Sequences for d3g2cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g2cb_ d.151.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vlkiiswnvnglravhrkgflkwfmeekpdilclqeikaapeqlprklrhvegyrsfftp
aerkgysgvamytkvppsslregfgverfdtegriqiadfddfllyniyfpngkmseerl
kyklefydafledvnrerdsgrnviicgdfntahreidlarpkensnvsgflpverawid
kfiengyvdtfrmfnsdpgqytwwsyrtrarernvgwrldyffvneefkgkvkrswilsd
vmgsdhcpigleiel

SCOPe Domain Coordinates for d3g2cb_:

Click to download the PDB-style file with coordinates for d3g2cb_.
(The format of our PDB-style files is described here.)

Timeline for d3g2cb_: