Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) automatically mapped to Pfam PF01701 |
Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins) |
Protein automated matches [236565] (1 species) not a true protein |
Species Synechocystis sp. [TaxId:1148] [236571] (1 PDB entry) |
Domain d4kt0j_: 4kt0 J: [236686] Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0e_, d4kt0f_ automated match to d1jb0j_ complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4 |
PDB Entry: 4kt0 (more details), 2.8 Å
SCOPe Domain Sequences for d4kt0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kt0j_ f.23.18.1 (J:) automated matches {Synechocystis sp. [TaxId: 1148]} mdglksflstapvmimalltftagiliefnrfypdllfhp
Timeline for d4kt0j_: