Lineage for d4kt0j_ (4kt0 J:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958308Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 1958309Family f.23.18.1: Subunit IX of photosystem I reaction centre, PsaJ [81543] (2 proteins)
  6. 1958313Protein automated matches [236565] (1 species)
    not a true protein
  7. 1958314Species Synechocystis sp. [TaxId:1148] [236571] (1 PDB entry)
  8. 1958315Domain d4kt0j_: 4kt0 J: [236686]
    Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0e_, d4kt0f_
    automated match to d1jb0j_
    complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0j_

PDB Entry: 4kt0 (more details), 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d4kt0j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kt0j_ f.23.18.1 (J:) automated matches {Synechocystis sp. [TaxId: 1148]}
mdglksflstapvmimalltftagiliefnrfypdllfhp

SCOPe Domain Coordinates for d4kt0j_:

Click to download the PDB-style file with coordinates for d4kt0j_.
(The format of our PDB-style files is described here.)

Timeline for d4kt0j_: