SCOPe 2.05: Domain d4kt0f_: 4kt0 F:

Lineage for d4kt0f_ (4kt0 F:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.1: Subunit III of photosystem I reaction centre, PsaF [81535] (2 proteins)

6. Protein automated matches [236583] (1 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [236584] (1 PDB entry)

8. Domain d4kt0f_: 4kt0 F: [236683]
   Other proteins in same PDB: d4kt0a_, d4kt0b_, d4kt0c_, d4kt0d_, d4kt0e_, d4kt0j_
   automated match to d1jb0f_
   complexed with bcr, cl, cl0, cla, lhg, lmg, lmu, pqn, sf4

Details for d4kt0f_

PDB Entry: 4kt0, 2.8 Å

PDB Description: Crystal structure of a virus like photosystem I from the cyanobacterium Synechocystis PCC 6803

PDB Compounds: (F:) Photosystem I subunit III

SCOPe Domain Sequences for d4kt0f_:

Sequence; same for both SEQRES and ATOM records:

>d4kt0f_ f.23.16.1 (F:) automated matches {Synechocystis sp. [TaxId: 1148]}
dfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrftha
gdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwplaa
vgeytsgklvmkdseiptspr

Timeline for d4kt0f_:

• d4kt0f_ first appeared in SCOPe 2.03
  
• d4kt0f_ appears in SCOPe 2.04
  
• d4kt0f_ appears in SCOPe 2.06
  
• d4kt0f_ appears in the current release, SCOPe 2.08